Catalogue Number: 14-511ACL-ABO
Manufacturer: | Abeomics |
Type: | Cell Lines |
Shipping Condition: | Dry Ice |
Storage Condition: | Liquid N2 |
Unit(s): | 1 vial |
Application: | FA |
Description: NKp30 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human activating Natural Killer cell receptor 30 (NKp30, also known as Natural Cytotoxicity triggering Receptor 3 (NCR3) or CD337). Sequence data: hNKp30 (accession number NP_667341) MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEV VPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTG NGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV PAPLPPPCGSSAHLLPPVPGG
Applicatio: Screen for antibodies of human NKp30 through Flow Cytometry. Culture conditions: Cells should be grown at 37°C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37°C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37°C-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
Immediately upon receipt, store in liquid nitrogen.