Anti-Wnt7a Polyclonal Antibody

Catalogue Number: 39-2011-ABO

Manufacturer:	Abeomics
Shelf Life:	12 months
Physical state:	Lyophilized
Type:	Polyclonal Primary Antibody - Unconjugated
Alias:	Protein Wnt-7a; WNT7A
Shipping Condition:	Blue Ice
Unit(s):	100 ug
Host name:	Rabbit
Clone:
Isotype:	IgG
Immunogen:	A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related Mouse sequence.
Application:	IHC-P, WB

Overview
Datasheets

Description

Description: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas - Rothschild / Schinzel phocomelia syndromes.

Additional Text

Gene Name

WNT7A

Gene ID

7476

Uniprot ID

O00755

Purification

Affinity Purified

Antibody Clonality

Polyclonal

Application Notes

Western blot : 0.1-0.5µg/ml; Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml

Storage Note

At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

39-2011 MSDS

39-2011 Datasheet

Price

£638.00

-

Quantity
Unit Size

Find out about delivery