Catalogue Number: PD00731-NZY
Manufacturer: | NZYTech |
Type: | Other Proteins |
Host Cell: | E.coli |
Shipping Condition: | RT |
Unit(s): | 0.25 mg |
Description: The protein is provided in 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2 and 25% (v/v) glycerol, at a 0.5 mg/mL concentration. Sequence: QAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKPLPLSPEE
Purified
MPDZ_3 PDZ Domain from Homo sapiens is a recombinant protein purified from Escherichia coli.