Alpha-like toxin Bom4, recombinant venom peptide

Catalogue Number: VP0006-NZY

Manufacturer:NZYTech
Type:Peptide
Shipping Condition:Blue Ice
Storage Condition:2-8°C
Unit(s): 0.1 mg

Description

Description: Alpha-like toxin Bom4 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Buthus occitanus mardochei (Moroccan scorpion). Bom4 toxin binds voltage-independently sodium channels (Nav) and inhibits sodium channels inactivation, thereby blocking neuronal transmission. This alpha-like toxin was described as highly toxic to mice and insects. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.2 mg/mL concentration. Sequence: GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC

Additional Text

Short Description

Sequence: GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC