Catalogue Number: VP0006-NZY
Manufacturer: | NZYTech |
Type: | Peptide |
Shipping Condition: | Blue Ice |
Storage Condition: | 2-8°C |
Unit(s): | 0.1 mg |
Description: Alpha-like toxin Bom4 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Buthus occitanus mardochei (Moroccan scorpion). Bom4 toxin binds voltage-independently sodium channels (Nav) and inhibits sodium channels inactivation, thereby blocking neuronal transmission. This alpha-like toxin was described as highly toxic to mice and insects. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.2 mg/mL concentration. Sequence: GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC
Sequence: GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC