Catalogue Number: VP0007-NZY
Manufacturer: | NZYTech |
Type: | Peptide |
Shipping Condition: | Blue Ice |
Storage Condition: | 2-8°C |
Unit(s): | 50 ug |
Description: Insecticidal LalT1 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Liocheles australasiae (Dwarf wood scorpion). The endogenous Insecticidal LalT1 peptide affects the activity of both ryanodinesensitive calcium-release channels RyR1 and RyR2. This venom peptide binds to different sites on the RyRs channels with highaffinity, mediating the full openings of these channels. Matsushita et al. described that insecticidal LalT1 venom peptide has insect toxicity activity against crickets but no toxicity was observed against mice, suggesting that the effect of this toxin is insect-selective. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration. Sequence: GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK
Sequence: GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK