Potassium channel toxin Aek, recombinant venom peptide
Catalogue Number: VP0009-NZY
| Manufacturer: | NZYTech |
| Type: | Peptide |
| Shipping Condition: | Blue Ice |
| Storage Condition: | 2-8°C |
| Unit(s): | 0.2 mg |
Description
Description: Potassium channel toxin Aek venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of sea anemone Actinia equina (Beadlet anemone). Aek toxin binds to voltage-dependent potassium channels (Kv1/KCNA), thereby inhibiting the binding of 125I-alphadendrotoxin to rat synaptosomal membranes (Minagawa, S. et al. ). The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.4 mg/mL concentration. Sequence: MICHNQQSSQPPTIKTCPGETNCYKKRWRDHRGTIIERGCGCPSVKKGVGIYCCKTNKCNR
Additional Text
Short Description
Sequence: MICHNQQSSQPPTIKTCPGETNCYKKRWRDHRGTIIERGCGCPSVKKGVGIYCCKTNKCNR
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations