Waglerin-4, recombinant venom peptide

Catalogue Number: VP0016-NZY

Manufacturer:	NZYTech
Type:	Peptide
Shipping Condition:	Blue Ice
Storage Condition:	2-8°C
Unit(s):	50 ug

Overview

Description

Description: Waglerin-4 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Tropidolaemus wagleri (temple pit viper). Waglerins are a group of four small peptides (waglerin-1, waglerin-2, waglerin-3 and waglerin-4) that were isolated from the venom of Temple pit viper. These small peptides are described as antagonists of the nicotinic acetylcholine receptor (nAChR) and have long been used as tools for the characterization of the nAChR. Waglerins block nAChR inhibiting the acetylcholine ligation to receptor. Several studies report that these small peptides cause paralysis and death by respiratory failure (Molles et al. , 2002). Waglerin-4 peptide was described as a selective inhibitor that blocks the epsilon form of the nAChR. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration. Sequence: IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA

Additional Text

Short Description

Sequence: IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA

Price

£468.00

-

Quantity
Unit Size

Find out about delivery