Kunitz-type kappaPI-theraphotoxin-Hs1a, recombinant venom peptide

Catalogue Number: VP0021-NZY

Manufacturer:NZYTech
Type:Peptide
Shipping Condition:Blue Ice
Storage Condition:2-8°C
Unit(s): 50 ug

Description

Description: Kunitz-type kappaPI-theraphotoxin-Hs1a venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Haplopelma schmidti (Chinese bird spider). Yuan et al. described the endogenous venom peptide as a potent inhibitor of serine proteases (trypsin). Besides serine protease inhibition, this peptide has also the ability to block ion channels, specifically the voltage-gated potassium channels, which are essential for regulation of several physiological processes. This peptide is also known as Huwentoxin-XI or Kunitz-type serine protease inhibitor huwentoxin-11. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration. Sequence: IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA

Additional Text

Short Description

Sequence: IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA